Back to Resultset

ID 2078    NAME Cupiennin 1c   Blast NCBI-PROT
LENGTH 35    DISULFIDE
BRIDGE
   
View PDB
SEQUENCE GFGSLFKFLAKKVAKTVAKQAAKQGAKYIANKQTE

   
HELICITY 94.30    INSTAB. INDEX 33.13    FLEXIBILITY 12.17   
a HYD. MOM. 29.03    b HYD. MOM. 6.89    c HYD. MOM 2.50   
a MEAN HYD.
MOM.
0.83    b MEAN HYD.
MOM.
0.20    c MEAN HYD.
MOM.
0.07   
CHARGE pH5 7.15    CHARGE pH7 7.00    CHARGE pH9 6.49   
Δ CHARGE pH5-pH9 0.66    ISOELECTRIC POINT 10.30    BOMAN INDEX 1.03   
ΔG 27    CPP -0,30    MLP -25,06   
MOLECULAR VOLUME     POLARITY        
MIC E. coli     MIC P. aeruginosa     MIC S. typhimurium    
MIC S. aureus     MIC M. luteus     MIC B. subtilis    
MIC C. albicans     OTHER    
MIC OTHER
gram+
   
MIC OTHER
gram-
   
PHYLUM Arthropoda    CLASS Arachnida    ORDER Araneae   
FAMILY Ctenidae    GENUS Cupiennius    SPECIES Cupiennius salei   
DATE 2002   
TITLE PAPER Cupiennin 1, a New Family of Highly Basic Antimicrobial Peptides in the Venom of the Spider Cupiennius salei (Ctenidae)